PHC2 monoclonal antibody (M01), clone 1F4 View larger

PHC2 monoclonal antibody (M01), clone 1F4

H00001912-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHC2 monoclonal antibody (M01), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about PHC2 monoclonal antibody (M01), clone 1F4

Brand: Abnova
Reference: H00001912-M01
Product name: PHC2 monoclonal antibody (M01), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant PHC2.
Clone: 1F4
Isotype: IgG2a Kappa
Gene id: 1912
Gene name: PHC2
Gene alias: EDR2|HPH2|MGC163502|PH2
Gene description: polyhomeotic homolog 2 (Drosophila)
Genbank accession: NM_004427
Immunogen: PHC2 (NP_004418.2, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE
Protein accession: NP_004418.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001912-M01-13-15-1.jpg
Application image note: Western Blot analysis of PHC2 expression in transfected 293T cell line by PHC2 monoclonal antibody (M01), clone 1F4.

Lane 1: PHC2 transfected lysate (Predicted MW: 35.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PHC2 monoclonal antibody (M01), clone 1F4 now

Add to cart