Brand: | Abnova |
Reference: | H00001911-M05 |
Product name: | PHC1 monoclonal antibody (M05), clone 3G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHC1. |
Clone: | 3G1 |
Isotype: | IgG2b Kappa |
Gene id: | 1911 |
Gene name: | PHC1 |
Gene alias: | EDR1|HPH1|RAE28 |
Gene description: | polyhomeotic homolog 1 (Drosophila) |
Genbank accession: | NM_004426 |
Immunogen: | PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY* |
Protein accession: | NP_004417 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PHC1 is approximately 3ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |