Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001907-M01 |
Product name: | EDN2 monoclonal antibody (M01), clone 3B4-1C5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant EDN2. |
Clone: | 3B4-1C5 |
Isotype: | IgG2b kappa |
Gene id: | 1907 |
Gene name: | EDN2 |
Gene alias: | ET2|PPET2 |
Gene description: | endothelin 2 |
Genbank accession: | BC034393 |
Immunogen: | EDN2 (AAH34393, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR |
Protein accession: | AAH34393 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.32 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EDN2 expression in transfected 293T cell line by EDN2 monoclonal antibody (M01), clone 3B4-1C5. Lane 1: EDN2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Estrogen and progesterone regulate expression of the endothelins in the rhesus macaque endometrium.Keator CS, Mah K, Ohm L, Slayden OD. Hum Reprod. 2011 Apr 19. [Epub ahead of print] |