EDN1 monoclonal antibody (M01), clone 3D6 View larger

EDN1 monoclonal antibody (M01), clone 3D6

H00001906-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDN1 monoclonal antibody (M01), clone 3D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about EDN1 monoclonal antibody (M01), clone 3D6

Brand: Abnova
Reference: H00001906-M01
Product name: EDN1 monoclonal antibody (M01), clone 3D6
Product description: Mouse monoclonal antibody raised against a partial recombinant EDN1.
Clone: 3D6
Isotype: IgG2a kappa
Gene id: 1906
Gene name: EDN1
Gene alias: ET1|HDLCQ7
Gene description: endothelin 1
Genbank accession: BC009720
Immunogen: EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Protein accession: AAH09720
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001906-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001906-M01-13-15-1.jpg
Application image note: Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6.

Lane 1: EDN1 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.Marion A, Dieudonne FX, Patino-Garcia A, Lecanda F, Marie PJ, Modrowski D.
Int J Cancer. 2012 Jun 1;130(11):2514-25. doi: 10.1002/ijc.26246. Epub 2011 Aug 16.

Reviews

Buy EDN1 monoclonal antibody (M01), clone 3D6 now

Add to cart