Brand: | Abnova |
Reference: | H00001903-M02 |
Product name: | EDG3 monoclonal antibody (M02), clone 2G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDG3. |
Clone: | 2G11 |
Isotype: | IgG1 Kappa |
Gene id: | 1903 |
Gene name: | S1PR3 |
Gene alias: | EDG-3|EDG3|FLJ37523|FLJ93220|LPB3|MGC71696|S1P3 |
Gene description: | sphingosine-1-phosphate receptor 3 |
Genbank accession: | NM_005226 |
Immunogen: | EDG3 (NP_005217.2, 302 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN |
Protein accession: | NP_005217.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to S1PR3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |