ECHS1 purified MaxPab mouse polyclonal antibody (B01P) View larger

ECHS1 purified MaxPab mouse polyclonal antibody (B01P)

H00001892-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ECHS1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about ECHS1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001892-B01P
Product name: ECHS1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ECHS1 protein.
Gene id: 1892
Gene name: ECHS1
Gene alias: SCEH
Gene description: enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Genbank accession: NM_004092.2
Immunogen: ECHS1 (NP_004083.2, 1 a.a. ~ 290 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAALRVLLSCARGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Protein accession: NP_004083.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001892-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ECHS1 expression in transfected 293T cell line (H00001892-T01) by ECHS1 MaxPab polyclonal antibody.

Lane 1: ECHS1 transfected lysate(31.9 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ECHS1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart