ECH1 MaxPab rabbit polyclonal antibody (D01) View larger

ECH1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ECH1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about ECH1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00001891-D01
Product name: ECH1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human ECH1 protein.
Gene id: 1891
Gene name: ECH1
Gene alias: HPXEL
Gene description: enoyl Coenzyme A hydratase 1, peroxisomal
Genbank accession: NM_001398.2
Immunogen: ECH1 (NP_001389.2, 1 a.a. ~ 328 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Protein accession: NP_001389.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001891-D01-13-15-1.jpg
Application image note: Western Blot analysis of ECH1 expression in transfected 293T cell line (H00001891-T01) by ECH1 MaxPab polyclonal antibody.

Lane 1: ECH1 transfected lysate(35.8 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy ECH1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart