Brand: | Abnova |
Reference: | H00001854-Q02 |
Product name: | DUT (Human) Recombinant Protein (Q02) |
Product description: | Human DUT partial ORF ( AAH33645.1, 41 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 1854 |
Gene name: | DUT |
Gene alias: | FLJ20622|dUTPase |
Gene description: | deoxyuridine triphosphatase |
Genbank accession: | BC033645 |
Immunogen sequence/protein sequence: | GSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE |
Protein accession: | AAH33645.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |