Brand: | Abnova |
Reference: | H00001847-M05A |
Product name: | DUSP5 monoclonal antibody (M05A), clone 6D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DUSP5. |
Clone: | 6D1 |
Isotype: | IgG1 Kappa |
Gene id: | 1847 |
Gene name: | DUSP5 |
Gene alias: | DUSP|HVH3 |
Gene description: | dual specificity phosphatase 5 |
Genbank accession: | NM_004419 |
Immunogen: | DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
Protein accession: | NP_004410 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |