DUSP5 monoclonal antibody (M05A), clone 6D1 View larger

DUSP5 monoclonal antibody (M05A), clone 6D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP5 monoclonal antibody (M05A), clone 6D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DUSP5 monoclonal antibody (M05A), clone 6D1

Brand: Abnova
Reference: H00001847-M05A
Product name: DUSP5 monoclonal antibody (M05A), clone 6D1
Product description: Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Clone: 6D1
Isotype: IgG1 Kappa
Gene id: 1847
Gene name: DUSP5
Gene alias: DUSP|HVH3
Gene description: dual specificity phosphatase 5
Genbank accession: NM_004419
Immunogen: DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Protein accession: NP_004410
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001847-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DUSP5 monoclonal antibody (M05A), clone 6D1 now

Add to cart