DTYMK monoclonal antibody (M02), clone 2G11 View larger

DTYMK monoclonal antibody (M02), clone 2G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DTYMK monoclonal antibody (M02), clone 2G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about DTYMK monoclonal antibody (M02), clone 2G11

Brand: Abnova
Reference: H00001841-M02
Product name: DTYMK monoclonal antibody (M02), clone 2G11
Product description: Mouse monoclonal antibody raised against a partial recombinant DTYMK.
Clone: 2G11
Isotype: IgG1 Kappa
Gene id: 1841
Gene name: DTYMK
Gene alias: CDC8|FLJ44192|TMPK|TYMK
Gene description: deoxythymidylate kinase (thymidylate kinase)
Genbank accession: NM_012145
Immunogen: DTYMK (NP_036277, 103 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Protein accession: NP_036277
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001841-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001841-M02-1-1-1.jpg
Application image note: DTYMK monoclonal antibody (M02), clone 2G11. Western Blot analysis of DTYMK expression in HeLa.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DTYMK monoclonal antibody (M02), clone 2G11 now

Add to cart