Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001841-M01A |
Product name: | DTYMK monoclonal antibody (M01A), clone 2C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DTYMK. |
Clone: | 2C2 |
Isotype: | IgM Kappa |
Gene id: | 1841 |
Gene name: | DTYMK |
Gene alias: | CDC8|FLJ44192|TMPK|TYMK |
Gene description: | deoxythymidylate kinase (thymidylate kinase) |
Genbank accession: | NM_012145 |
Immunogen: | DTYMK (NP_036277, 103 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK |
Protein accession: | NP_036277 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DTYMK expression in transfected 293T cell line by DTYMK monoclonal antibody (M01A), clone 2C2. Lane 1: DTYMK transfected lysate (Predicted MW: 23.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |