DTYMK polyclonal antibody (A01) View larger

DTYMK polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DTYMK polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about DTYMK polyclonal antibody (A01)

Brand: Abnova
Reference: H00001841-A01
Product name: DTYMK polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DTYMK.
Gene id: 1841
Gene name: DTYMK
Gene alias: CDC8|FLJ44192|TMPK|TYMK
Gene description: deoxythymidylate kinase (thymidylate kinase)
Genbank accession: NM_012145
Immunogen: DTYMK (NP_036277, 103 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Protein accession: NP_036277
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001841-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001841-A01-1-2-1.jpg
Application image note: DTYMK polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of DTYMK expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DTYMK polyclonal antibody (A01) now

Add to cart