Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC26A2 monoclonal antibody (M04), clone 3F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SLC26A2 monoclonal antibody (M04), clone 3F6
| Brand: | Abnova |
| Reference: | H00001836-M04 |
| Product name: | SLC26A2 monoclonal antibody (M04), clone 3F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC26A2. |
| Clone: | 3F6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1836 |
| Gene name: | SLC26A2 |
| Gene alias: | D5S1708|DTD|DTDST|EDM4|MST153|MSTP157 |
| Gene description: | solute carrier family 26 (sulfate transporter), member 2 |
| Genbank accession: | NM_000112 |
| Immunogen: | SLC26A2 (NP_000103.1, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNI |
| Protein accession: | NP_000103.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SLC26A2 expression in transfected 293T cell line by SLC26A2 monoclonal antibody (M04), clone 3F6. Lane 1: SLC26A2 transfected lysate(81.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Epigenetic Silencing of the Sulfate Transporter Gene DTDST Induces Sialyl Lewisx Expression and Accelerates Proliferation of Colon Cancer Cells.Yusa A, Miyazaki K, Kimura N, Izawa M, Kannagi R. Cancer Res. 2010 May 15;70(10):4064-73. Epub 2010 May 11. |