ARID3A monoclonal antibody (M01), clone 1A11 View larger

ARID3A monoclonal antibody (M01), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARID3A monoclonal antibody (M01), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,RNAi-Ab

More info about ARID3A monoclonal antibody (M01), clone 1A11

Brand: Abnova
Reference: H00001820-M01
Product name: ARID3A monoclonal antibody (M01), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant ARID3A.
Clone: 1A11
Isotype: IgG1 Kappa
Gene id: 1820
Gene name: ARID3A
Gene alias: BRIGHT|DRIL1|DRIL3|E2FBP1
Gene description: AT rich interactive domain 3A (BRIGHT-like)
Genbank accession: NM_005224
Immunogen: ARID3A (NP_005215, 317 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Protein accession: NP_005215
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001820-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001820-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,RNAi-Ab
Shipping condition: Dry Ice
Publications: Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry.Kang UB, Yeom J, Kim HJ, Kim H, Lee C.
J Proteomics. 2011 Nov 26.

Reviews

Buy ARID3A monoclonal antibody (M01), clone 1A11 now

Add to cart