Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DRD2 monoclonal antibody (M01A), clone 1B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DRD2 monoclonal antibody (M01A), clone 1B11
| Brand: | Abnova |
| Reference: | H00001813-M01A |
| Product name: | DRD2 monoclonal antibody (M01A), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DRD2. |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1813 |
| Gene name: | DRD2 |
| Gene alias: | D2DR|D2R |
| Gene description: | dopamine receptor D2 |
| Genbank accession: | BC021195 |
| Immunogen: | DRD2 (AAH21195, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIF |
| Protein accession: | AAH21195 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DRD2 monoclonal antibody (M01A), clone 1B11 Western Blot analysis of DRD2 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SCH23390, a dopamine D(1) receptor antagonist, suppressed scratching behavior induced by compound 48/80 in mice.Akimoto Y, Furuse M. Eur J Pharmacol. 2011 Sep 21. |