Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC26A3 monoclonal antibody (M01), clone 2E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about SLC26A3 monoclonal antibody (M01), clone 2E3
| Brand: | Abnova |
| Reference: | H00001811-M01 |
| Product name: | SLC26A3 monoclonal antibody (M01), clone 2E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC26A3. |
| Clone: | 2E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1811 |
| Gene name: | SLC26A3 |
| Gene alias: | CLD|DRA |
| Gene description: | solute carrier family 26, member 3 |
| Genbank accession: | NM_000111 |
| Immunogen: | SLC26A3 (NP_000102, 503 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT |
| Protein accession: | NP_000102 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SLC26A3 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.8 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ION TRANSPORT MECHANISMS LINKED TO BICARBONATE SECRETION IN THE ESOPHAGEAL SUBMUCOSAL GLANDS.Abdulnour-Nakhoul S, Nakhoul HN, Kalliny MI, Gyftopoulos A, Rabon E, Doetjes R, Brown K, Nakhoul NL. Am J Physiol Regul Integr Comp Physiol. 2011 Apr 6. [Epub ahead of print] |