Brand: | Abnova |
Reference: | H00001809-M01 |
Product name: | DPYSL3 monoclonal antibody (M01), clone 1B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPYSL3. |
Clone: | 1B8 |
Isotype: | IgG2a Kappa |
Gene id: | 1809 |
Gene name: | DPYSL3 |
Gene alias: | CRMP-4|CRMP4|DRP-3|DRP3|LCRMP|ULIP |
Gene description: | dihydropyrimidinase-like 3 |
Genbank accession: | NM_001387 |
Immunogen: | DPYSL3 (NP_001378, 457 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKR |
Protein accession: | NP_001378 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DPYSL3 monoclonal antibody (M01), clone 1B8 Western Blot analysis of DPYSL3 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |