Brand: | Abnova |
Reference: | H00001807-M01 |
Product name: | DPYS monoclonal antibody (M01), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPYS. |
Clone: | 3B1 |
Isotype: | IgG1 Kappa |
Gene id: | 1807 |
Gene name: | DPYS |
Gene alias: | DHP|DHPase |
Gene description: | dihydropyrimidinase |
Genbank accession: | NM_001385 |
Immunogen: | DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP |
Protein accession: | NP_001376 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPYS is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |