DPP4 monoclonal antibody (M03), clone 1C5 View larger

DPP4 monoclonal antibody (M03), clone 1C5

H00001803-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DPP4 monoclonal antibody (M03), clone 1C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about DPP4 monoclonal antibody (M03), clone 1C5

Brand: Abnova
Reference: H00001803-M03
Product name: DPP4 monoclonal antibody (M03), clone 1C5
Product description: Mouse monoclonal antibody raised against a partial recombinant DPP4.
Clone: 1C5
Isotype: IgG1 Kappa
Gene id: 1803
Gene name: DPP4
Gene alias: ADABP|ADCP2|CD26|DPPIV|TP103
Gene description: dipeptidyl-peptidase 4
Genbank accession: BC065265
Immunogen: DPP4 (AAH65265, 352 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP
Protein accession: AAH65265
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001803-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged DPP4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy DPP4 monoclonal antibody (M03), clone 1C5 now

Add to cart