Brand: | Abnova |
Reference: | H00001798-M04 |
Product name: | DPAGT1 monoclonal antibody (M04), clone 1G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPAGT1. |
Clone: | 1G1 |
Isotype: | IgG2a Kappa |
Gene id: | 1798 |
Gene name: | DPAGT1 |
Gene alias: | ALG7|CDG-Ij|D11S366|DGPT|DPAGT|DPAGT2|G1PT|GPT|UAGT|UGAT |
Gene description: | dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) |
Genbank accession: | NM_001382 |
Immunogen: | DPAGT1 (NP_001373, 296 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER |
Protein accession: | NP_001373 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPAGT1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |