DNMT1 monoclonal antibody (M01A), clone 2B5 View larger

DNMT1 monoclonal antibody (M01A), clone 2B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNMT1 monoclonal antibody (M01A), clone 2B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DNMT1 monoclonal antibody (M01A), clone 2B5

Brand: Abnova
Reference: H00001786-M01A
Product name: DNMT1 monoclonal antibody (M01A), clone 2B5
Product description: Mouse monoclonal antibody raised against a partial recombinant DNMT1.
Clone: 2B5
Isotype: IgG1 Kappa
Gene id: 1786
Gene name: DNMT1
Gene alias: AIM|CXXC9|DNMT|FLJ16293|MCMT|MGC104992
Gene description: DNA (cytosine-5-)-methyltransferase 1
Genbank accession: NM_001379
Immunogen: DNMT1 (NP_001370, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG
Protein accession: NP_001370
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001786-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DNMT1 monoclonal antibody (M01A), clone 2B5 now

Add to cart