Brand: | Abnova |
Reference: | H00001785-M01 |
Product name: | DNM2 monoclonal antibody (M01), clone 6C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DNM2. |
Clone: | 6C9 |
Isotype: | IgG1 Kappa |
Gene id: | 1785 |
Gene name: | DNM2 |
Gene alias: | CMTDI1|CMTDIB|DI-CMTB|DYN2|DYNII |
Gene description: | dynamin 2 |
Genbank accession: | BC054501 |
Immunogen: | DNM2 (AAH54501, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAD |
Protein accession: | AAH54501 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DNM2 monoclonal antibody (M01), clone 6C9 Western Blot analysis of DNM2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |