Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DMPK monoclonal antibody (M01), clone 2F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about DMPK monoclonal antibody (M01), clone 2F7
| Brand: | Abnova |
| Reference: | H00001760-M01 |
| Product name: | DMPK monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DMPK. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1760 |
| Gene name: | DMPK |
| Gene alias: | DM|DM1|DM1PK|DMK|MDPK|MT-PK |
| Gene description: | dystrophia myotonica-protein kinase |
| Genbank accession: | BC062553 |
| Immunogen: | DMPK (AAH62553, 303 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP |
| Protein accession: | AAH62553 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi ( Cat # H00001760-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DMPK monoclonal antibody (M01) clone 2F7 (Cat # H00001760-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |