DLX5 monoclonal antibody (M01), clone 1B3 View larger

DLX5 monoclonal antibody (M01), clone 1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLX5 monoclonal antibody (M01), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about DLX5 monoclonal antibody (M01), clone 1B3

Brand: Abnova
Reference: H00001749-M01
Product name: DLX5 monoclonal antibody (M01), clone 1B3
Product description: Mouse monoclonal antibody raised against a partial recombinant DLX5.
Clone: 1B3
Isotype: IgG2a Kappa
Gene id: 1749
Gene name: DLX5
Gene alias: -
Gene description: distal-less homeobox 5
Genbank accession: NM_005221
Immunogen: DLX5 (NP_005212, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
Protein accession: NP_005212
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001749-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DLX5 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy DLX5 monoclonal antibody (M01), clone 1B3 now

Add to cart