DLX4 purified MaxPab rabbit polyclonal antibody (D01P) View larger

DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about DLX4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001748-D01P
Product name: DLX4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DLX4 protein.
Gene id: 1748
Gene name: DLX4
Gene alias: BP1|DLX7|DLX8|DLX9
Gene description: distal-less homeobox 4
Genbank accession: NM_138281.1
Immunogen: DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Protein accession: NP_612138.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001748-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DLX4 expression in transfected 293T cell line (H00001748-T01) by DLX4 MaxPab polyclonal antibody.

Lane 1: DLX4 transfected lysate(26.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DLX4 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart