Brand: | Abnova |
Reference: | H00001746-M07 |
Product name: | DLX2 monoclonal antibody (M07), clone 3H3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant DLX2. |
Clone: | 3H3 |
Isotype: | IgG2a Kappa |
Gene id: | 1746 |
Gene name: | DLX2 |
Gene alias: | TES-1|TES1 |
Gene description: | distal-less homeobox 2 |
Genbank accession: | NM_004405 |
Immunogen: | DLX2 (NP_004396, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGT |
Protein accession: | NP_004396 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DLX2 is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |