Brand: | Abnova |
Reference: | H00001746-M02 |
Product name: | DLX2 monoclonal antibody (M02), clone 4B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DLX2. |
Clone: | 4B9 |
Isotype: | IgG2a Kappa |
Gene id: | 1746 |
Gene name: | DLX2 |
Gene alias: | TES-1|TES1 |
Gene description: | distal-less homeobox 2 |
Genbank accession: | NM_004405.3 |
Immunogen: | DLX2 (NP_004396.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL |
Protein accession: | NP_004396.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to DLX2 on formalin-fixed paraffin-embedded human lung. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |