DLX2 monoclonal antibody (M02), clone 4B9 View larger

DLX2 monoclonal antibody (M02), clone 4B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLX2 monoclonal antibody (M02), clone 4B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about DLX2 monoclonal antibody (M02), clone 4B9

Brand: Abnova
Reference: H00001746-M02
Product name: DLX2 monoclonal antibody (M02), clone 4B9
Product description: Mouse monoclonal antibody raised against a partial recombinant DLX2.
Clone: 4B9
Isotype: IgG2a Kappa
Gene id: 1746
Gene name: DLX2
Gene alias: TES-1|TES1
Gene description: distal-less homeobox 2
Genbank accession: NM_004405.3
Immunogen: DLX2 (NP_004396.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Protein accession: NP_004396.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001746-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00001746-M02-3-1-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to DLX2 on formalin-fixed paraffin-embedded human lung. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DLX2 monoclonal antibody (M02), clone 4B9 now

Add to cart