Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DLX1 monoclonal antibody (M14), clone 4H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about DLX1 monoclonal antibody (M14), clone 4H7
| Brand: | Abnova |
| Reference: | H00001745-M14 |
| Product name: | DLX1 monoclonal antibody (M14), clone 4H7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DLX1. |
| Clone: | 4H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1745 |
| Gene name: | DLX1 |
| Gene alias: | - |
| Gene description: | distal-less homeobox 1 |
| Genbank accession: | NM_178120 |
| Immunogen: | DLX1 (NP_835221, 181 a.a. ~ 254 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL* |
| Protein accession: | NP_835221 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DLX1 expression in transfected 293T cell line by DLX1 monoclonal antibody (M14), clone 4H7. Lane 1: DLX1 transfected lysate(27.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |