DLX1 monoclonal antibody (M12), clone 1B2 View larger

DLX1 monoclonal antibody (M12), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLX1 monoclonal antibody (M12), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about DLX1 monoclonal antibody (M12), clone 1B2

Brand: Abnova
Reference: H00001745-M12
Product name: DLX1 monoclonal antibody (M12), clone 1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant DLX1.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 1745
Gene name: DLX1
Gene alias: -
Gene description: distal-less homeobox 1
Genbank accession: NM_178120
Immunogen: DLX1 (NP_835221, 181 a.a. ~ 254 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL*
Protein accession: NP_835221
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001745-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.25 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001745-M12-1-24-1.jpg
Application image note: DLX1 monoclonal antibody (M12), clone 1B2 Western Blot analysis of DLX1 expression in SW-13 ( Cat # L005V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DLX1 monoclonal antibody (M12), clone 1B2 now

Add to cart