DLST purified MaxPab rabbit polyclonal antibody (D01P) View larger

DLST purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLST purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,IF,WB-Tr

More info about DLST purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001743-D01P
Product name: DLST purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DLST protein.
Gene id: 1743
Gene name: DLST
Gene alias: DLTS
Gene description: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Genbank accession: NM_001933.3
Immunogen: DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Protein accession: NP_001924.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001743-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DLST expression in transfected 293T cell line (H00001743-T02) by DLST MaxPab polyclonal antibody.

Lane 1: DLST transfected lysate(48.80 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DLST purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart