Brand: | Abnova |
Reference: | H00001741-M03 |
Product name: | DLG3 monoclonal antibody (M03), clone 2B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DLG3. |
Clone: | 2B6 |
Isotype: | IgG2a Kappa |
Gene id: | 1741 |
Gene name: | DLG3 |
Gene alias: | KIAA1232|MRX|MRX90|NE-Dlg|NEDLG|SAP-102|SAP102 |
Gene description: | discs, large homolog 3 (Drosophila) |
Genbank accession: | NM_021120 |
Immunogen: | DLG3 (NP_066943, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDF |
Protein accession: | NP_066943 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi ( Cat # H00001741-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # H00001741-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |