Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DLG3 monoclonal antibody (M03), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about DLG3 monoclonal antibody (M03), clone 2B6
| Brand: | Abnova |
| Reference: | H00001741-M03 |
| Product name: | DLG3 monoclonal antibody (M03), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DLG3. |
| Clone: | 2B6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1741 |
| Gene name: | DLG3 |
| Gene alias: | KIAA1232|MRX|MRX90|NE-Dlg|NEDLG|SAP-102|SAP102 |
| Gene description: | discs, large homolog 3 (Drosophila) |
| Genbank accession: | NM_021120 |
| Immunogen: | DLG3 (NP_066943, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDF |
| Protein accession: | NP_066943 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi ( Cat # H00001741-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # H00001741-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |