Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DLG1 monoclonal antibody (M01), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,PLA-Ce |
More info about DLG1 monoclonal antibody (M01), clone 1D8
| Brand: | Abnova |
| Reference: | H00001739-M01 |
| Product name: | DLG1 monoclonal antibody (M01), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DLG1. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1739 |
| Gene name: | DLG1 |
| Gene alias: | DKFZp761P0818|DKFZp781B0426|DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg |
| Gene description: | discs, large homolog 1 (Drosophila) |
| Genbank accession: | NM_004087 |
| Immunogen: | DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS |
| Protein accession: | NP_004078 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between LCK and DLG1. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-DLG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |