Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEPT1 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
More info about SEPT1 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00001731-D01 |
| Product name: | SEPT1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SEPT1 protein. |
| Gene id: | 1731 |
| Gene name: | SEPT1 |
| Gene alias: | DIFF6|LARP|MGC20394|PNUTL3|SEP1 |
| Gene description: | septin 1 |
| Genbank accession: | NM_052838 |
| Immunogen: | SEPT1 (NP_443070.1, 1 a.a. ~ 367 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL |
| Protein accession: | NP_443070.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SEPT1 expression in transfected 293T cell line (H00001731-T02) by SEPT1 MaxPab polyclonal antibody. Lane 1: SEPT1 transfected lysate(42 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |