SEPT1 purified MaxPab mouse polyclonal antibody (B02P) View larger

SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00001731-B02P
Product name: SEPT1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human SEPT1 protein.
Gene id: 1731
Gene name: SEPT1
Gene alias: DIFF6|LARP|MGC20394|PNUTL3|SEP1
Gene description: septin 1
Genbank accession: NM_052838
Immunogen: SEPT1 (NP_443070.1, 1 a.a. ~ 367 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
Protein accession: NP_443070.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001731-B02P-1-7-1.jpg
Application image note: SEPT1 MaxPab polyclonal antibody. Western Blot analysis of SEPT1 expression in MCF-7.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEPT1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart