SEPT1 MaxPab mouse polyclonal antibody (B02) View larger

SEPT1 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT1 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about SEPT1 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00001731-B02
Product name: SEPT1 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human SEPT1 protein.
Gene id: 1731
Gene name: SEPT1
Gene alias: DIFF6|LARP|MGC20394|PNUTL3|SEP1
Gene description: septin 1
Genbank accession: NM_052838
Immunogen: SEPT1 (NP_443070, 1 a.a. ~ 367 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
Protein accession: NP_443070
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001731-B02-1-7-1.jpg
Application image note: SEPT1 MaxPab polyclonal antibody. Western Blot analysis of SEPT1 expression in MCF-7.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEPT1 MaxPab mouse polyclonal antibody (B02) now

Add to cart