DIAPH1 polyclonal antibody (A01) View larger

DIAPH1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIAPH1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DIAPH1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001729-A01
Product name: DIAPH1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DIAPH1.
Gene id: 1729
Gene name: DIAPH1
Gene alias: DFNA1|DIA1|DRF1|FLJ25265|LFHL1|hDIA1
Gene description: diaphanous homolog 1 (Drosophila)
Genbank accession: NM_005219
Immunogen: DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
Protein accession: NP_005210
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001729-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DIAPH1 polyclonal antibody (A01) now

Add to cart