Brand: | Abnova |
Reference: | H00001687-M01 |
Product name: | DFNA5 monoclonal antibody (M01), clone 1E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DFNA5. |
Clone: | 1E10 |
Isotype: | IgG2a Kappa |
Gene id: | 1687 |
Gene name: | DFNA5 |
Gene alias: | ICERE-1 |
Gene description: | deafness, autosomal dominant 5 |
Genbank accession: | NM_004403 |
Immunogen: | DFNA5 (NP_004394.1, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN |
Protein accession: | NP_004394.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DFNA5 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |