Brand: | Abnova |
Reference: | H00001678-M04 |
Product name: | TIMM8A monoclonal antibody (M04), clone 1A12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TIMM8A. |
Clone: | 1A12 |
Isotype: | IgG2a Kappa |
Gene id: | 1678 |
Gene name: | TIMM8A |
Gene alias: | DDP|DDP1|DFN1|MGC12262|MTS |
Gene description: | translocase of inner mitochondrial membrane 8 homolog A (yeast) |
Genbank accession: | BC005236 |
Immunogen: | TIMM8A (AAH05236, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN |
Protein accession: | AAH05236 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TIMM8A is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |