Brand: | Abnova |
Reference: | H00001677-A01 |
Product name: | DFFB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DFFB. |
Gene id: | 1677 |
Gene name: | DFFB |
Gene alias: | CAD|CPAN|DFF-40|DFF2|DFF40 |
Gene description: | DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase) |
Genbank accession: | NM_004402 |
Immunogen: | DFFB (NP_004393, 229 a.a. ~ 338 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ |
Protein accession: | NP_004393 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DFFB polyclonal antibody (A01), Lot # 050928JC01. Western Blot analysis of DFFB expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |