Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DFFA monoclonal antibody (M05), clone 3A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
More info about DFFA monoclonal antibody (M05), clone 3A11
| Brand: | Abnova |
| Reference: | H00001676-M05 |
| Product name: | DFFA monoclonal antibody (M05), clone 3A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DFFA. |
| Clone: | 3A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1676 |
| Gene name: | DFFA |
| Gene alias: | DFF-45|DFF1|ICAD |
| Gene description: | DNA fragmentation factor, 45kDa, alpha polypeptide |
| Genbank accession: | NM_004401 |
| Immunogen: | DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT |
| Protein accession: | NP_004392.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |