DEFA1 monoclonal antibody (M03), clone 1B20 View larger

DEFA1 monoclonal antibody (M03), clone 1B20

H00001667-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DEFA1 monoclonal antibody (M03), clone 1B20

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about DEFA1 monoclonal antibody (M03), clone 1B20

Brand: Abnova
Reference: H00001667-M03
Product name: DEFA1 monoclonal antibody (M03), clone 1B20
Product description: Mouse monoclonal antibody raised against a full-length recombinant DEFA1.
Clone: 1B20
Isotype: IgG2b Kappa
Gene id: 1667
Gene name: DEFA1
Gene alias: DEF1|DEFA2|HNP-1|HP-1|MGC138393|MRS
Gene description: defensin, alpha 1
Genbank accession: BC027917
Immunogen: DEFA1 (AAH27917, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Protein accession: AAH27917
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy DEFA1 monoclonal antibody (M03), clone 1B20 now

Add to cart