DHX8 monoclonal antibody (M01), clone 1E10 View larger

DHX8 monoclonal antibody (M01), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHX8 monoclonal antibody (M01), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about DHX8 monoclonal antibody (M01), clone 1E10

Brand: Abnova
Reference: H00001659-M01
Product name: DHX8 monoclonal antibody (M01), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant DHX8.
Clone: 1E10
Isotype: IgG2a Kappa
Gene id: 1659
Gene name: DHX8
Gene alias: DDX8|HRH1|PRP22|PRPF22
Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 8
Genbank accession: NM_004941
Immunogen: DHX8 (NP_004932, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Protein accession: NP_004932
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001659-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001659-M01-1-25-1.jpg
Application image note: DHX8 monoclonal antibody (M01), clone 1E10 Western Blot analysis of DHX8 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DHX8 monoclonal antibody (M01), clone 1E10 now

Add to cart