DDX1 monoclonal antibody (M02), clone 4F6 View larger

DDX1 monoclonal antibody (M02), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX1 monoclonal antibody (M02), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about DDX1 monoclonal antibody (M02), clone 4F6

Brand: Abnova
Reference: H00001653-M02
Product name: DDX1 monoclonal antibody (M02), clone 4F6
Product description: Mouse monoclonal antibody raised against a partial recombinant DDX1.
Clone: 4F6
Isotype: IgG2b Kappa
Gene id: 1653
Gene name: DDX1
Gene alias: DBP-RB|UKVH5d
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
Genbank accession: NM_004939
Immunogen: DDX1 (NP_004930, 642 a.a. ~ 740 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Protein accession: NP_004930
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001653-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001653-M02-1-25-1.jpg
Application image note: DDX1 monoclonal antibody (M02), clone 4F6. Western Blot analysis of DDX1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DDX1 monoclonal antibody (M02), clone 4F6 now

Add to cart