DDX1 polyclonal antibody (A01) View larger

DDX1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about DDX1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001653-A01
Product name: DDX1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DDX1.
Gene id: 1653
Gene name: DDX1
Gene alias: DBP-RB|UKVH5d
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
Genbank accession: NM_004939
Immunogen: DDX1 (NP_004930, 642 a.a. ~ 740 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Protein accession: NP_004930
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001653-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001653-A01-1-23-1.jpg
Application image note: DDX1 polyclonal antibody (A01), Lot # 060109JC01 Western Blot analysis of DDX1 expression in U-2 OS ( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DDX1 polyclonal antibody (A01) now

Add to cart