Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DDT monoclonal antibody (M01), clone 1G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about DDT monoclonal antibody (M01), clone 1G1
| Brand: | Abnova |
| Reference: | H00001652-M01 |
| Product name: | DDT monoclonal antibody (M01), clone 1G1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DDT. |
| Clone: | 1G1 |
| Isotype: | IgG2b kappa |
| Gene id: | 1652 |
| Gene name: | DDT |
| Gene alias: | DDCT |
| Gene description: | D-dopachrome tautomerase |
| Genbank accession: | BC005971 |
| Immunogen: | DDT (AAH05971, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
| Protein accession: | AAH05971 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DDT is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride.Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K. Toxicology. 2009 Jan 8;255(1-2):6-14. Epub 2008 Sep 27. |