Brand: | Abnova |
Reference: | H00001652-D01P |
Product name: | DDT purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human DDT protein. |
Gene id: | 1652 |
Gene name: | DDT |
Gene alias: | DDCT |
Gene description: | D-dopachrome tautomerase |
Genbank accession: | NM_001355 |
Immunogen: | DDT (NP_001346.1, 1 a.a. ~ 118 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
Protein accession: | NP_001346.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DDT MaxPab rabbit polyclonal antibody. Western Blot analysis of DDT expression in human spleen. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |