DDOST polyclonal antibody (A01) View larger

DDOST polyclonal antibody (A01)

H00001650-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDOST polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DDOST polyclonal antibody (A01)

Brand: Abnova
Reference: H00001650-A01
Product name: DDOST polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DDOST.
Gene id: 1650
Gene name: DDOST
Gene alias: AGE-R1|KIAA0115|MGC2191|OK/SW-cl.45|OST|OST48|WBP1
Gene description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase
Genbank accession: NM_005216
Immunogen: DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Protein accession: NP_005207
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001650-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Robust Immunohistochemical Staining of Several Classes of Proteins in Tissues Subjected to Autolysis.Maleszewski J, Lu J, Fox-Talbot K, Halushka MK.
J Histochem Cytochem. 2007 Jun;55(6):597-606. Epub 2007 Feb 20.

Reviews

Buy DDOST polyclonal antibody (A01) now

Add to cart