GADD45A purified MaxPab mouse polyclonal antibody (B01P) View larger

GADD45A purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GADD45A purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GADD45A purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001647-B01P
Product name: GADD45A purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GADD45A protein.
Gene id: 1647
Gene name: GADD45A
Gene alias: DDIT1|GADD45
Gene description: growth arrest and DNA-damage-inducible, alpha
Genbank accession: NM_001924
Immunogen: GADD45A (AAH11757.1, 1 a.a. ~ 165 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Protein accession: AAH11757.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001647-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GADD45A expression in transfected 293T cell line (H00001647-T01) by GADD45A MaxPab polyclonal antibody.

Lane 1: GADD45A transfected lysate(18.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GADD45A purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart