Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKR1C2 monoclonal antibody (M03A), clone 3C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about AKR1C2 monoclonal antibody (M03A), clone 3C11
| Brand: | Abnova |
| Reference: | H00001646-M03A |
| Product name: | AKR1C2 monoclonal antibody (M03A), clone 3C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKR1C2. |
| Clone: | 3C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1646 |
| Gene name: | AKR1C2 |
| Gene alias: | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2 |
| Gene description: | aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) |
| Genbank accession: | BC063574 |
| Immunogen: | AKR1C2 (AAH63574, 224 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPVSDEY |
| Protein accession: | AAH63574 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of AKR1C2 expression in transfected 293T cell line by AKR1C2 monoclonal antibody (M03A), clone 3C11. Lane 1: AKR1C2 transfected lysate(36.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |