Brand: | Abnova |
Reference: | H00001646-B03 |
Product name: | AKR1C2 MaxPab mouse polyclonal antibody (B03) |
Product description: | Mouse polyclonal antibody raised against a full-length human AKR1C2 protein. |
Gene id: | 1646 |
Gene name: | AKR1C2 |
Gene alias: | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2 |
Gene description: | aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) |
Genbank accession: | NM_001354.4 |
Immunogen: | AKR1C2 (AAH07024.1, 1 a.a. ~ 323 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Protein accession: | AAH07024.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AKR1C2 MaxPab polyclonal antibody. Western Blot analysis of AKR1C2 expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |